PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G0097
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 254aa    MW: 28480 Da    PI: 7.4652
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G0097genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+++Ed  lv++++++G+g +W t +r+ g++R++k+c++rw++yl
      Gh_D07G0097 14 KGPWSPDEDNTLVNYIHKHGTGgNWITLPRKAGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding44.73e-1469111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +   lG++ W+ Ia+ ++ gRt++++k++w++
      Gh_D07G0097  69 GGFSEEEDNIICSLYSTLGSR-WSVIAAQLP-GRTDNDIKNHWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.178962IPR017930Myb domain
SuperFamilySSF466891.05E-2711109IPR009057Homeodomain-like
SMARTSM007171.8E-111364IPR001005SANT/Myb domain
PfamPF002491.1E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-231569IPR009057Homeodomain-like
CDDcd001672.68E-91662No hitNo description
PROSITE profilePS5129422.7963117IPR017930Myb domain
SMARTSM007177.2E-1367115IPR001005SANT/Myb domain
PfamPF002497.0E-1369111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-2470117IPR009057Homeodomain-like
CDDcd001675.45E-1071111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MVRAPCCDKS NVRKGPWSPD EDNTLVNYIH KHGTGGNWIT LPRKAGLKRC GKSCRLRWLN  60
YLRPDIKHGG FSEEEDNIIC SLYSTLGSRW SVIAAQLPGR TDNDIKNHWN TKLKKKLLAA  120
KIKGGNNEIT TTISAAPFCK AVGSDGSSRT TSSSYMTDMK TYQKKYYEYP ALVLDQTDQF  180
SMPYLPFENN YGAAWCSNGV SNEGQGMMVD HFVDFEVDPQ HVLSGSSFQE ENINGVGDDP  240
WFGILSAIHY NIFD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27141177108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5890441e-81JX589044.1 Gossypium hirsutum clone NBRI_GE23653 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012446769.10.0PREDICTED: transcription factor RAX3-like
SwissprotQ9M2Y99e-72RAX3_ARATH; Transcription factor RAX3
TrEMBLA0A0D2PK370.0A0A0D2PK37_G
STRINGPOPTR_0006s25060.16e-73(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2448134
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.11e-66myb domain protein 84